PDB entry 2b4w

View 2b4w on RCSB PDB site
Description: Hypothetical protein from leishmania major
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, UNKNOWN FUNCTION
Deposited on 2005-09-26, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein, conserved
    Species: Leishmania major [TaxId:5664]
    Gene: LmjF10.1260
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QH86
      • modified residue (92)
      • modified residue (131)
      • modified residue (270)
      • modified residue (310)
    Domains in SCOPe 2.07: d2b4wa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4wA (A:)
    mkqvkaafeankrvyesvlltfkgvdgydvyncsvpfsykgkthiygrvekrdiwaashv
    rlfeetgkdeftavpelsweledpyiakinnemifggtrvrkngnailsyygyfyrgtpd
    eltyftrgpgcmkdirvlqlqdgrlgvfsrprvgrkasigfvilnsidelgaeviakapp
    ldilsenawggvnqayllssgkvgcighysyedtnekqqpqsvyvnyafvldpqsraitg
    akiigtkscyppcepkvplladcvfasgivmrsdgkvdlysgvgdshegritidypfkgh
    gtiigdlhfpmassl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4wA (A:)
    kqvkaafeankrvyesvlltfkgvdgydvyncsvpfsykgkthiygrvekrdiwaashvr
    lfeetgkdeftavpelsweledpyiakinnemifggtrvrilsyygyfyrgtpdeltyft
    rgpgcmkdirvlqlqdgrlgvfsrprvasigfvilnsidelgaeviakappldilnawgg
    vnqayllssgkvgcighysyeqsvyvnyafvldpqsraitgakiigtkscyppcepkvpl
    ladcvfasgivmrsdgkvdlysgvgdshegritidypfkghgtiigdlhfpm