PDB entry 2b4v

View 2b4v on RCSB PDB site
Description: Structural Basis for UTP Specificity of RNA Editing TUTases From Trypanosoma Brucei
Class: transferase/RNA binding protein
Keywords: TbRET2, Tbmp57, RNA editing, terminal Uridylyl transferase, Trypanosoma brucei, editosome, TRANSFERASE/RNA BINDING PROTEIN COMPLEX
Deposited on 2005-09-26, released 2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA editing complex protein MP57
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tbmp57
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86MV5
      • modified residue (24)
      • modified residue (36)
      • modified residue (66)
      • modified residue (72)
      • engineered (74)
      • modified residue (83)
      • engineered (102)
      • modified residue (178)
      • engineered (187)
      • modified residue (207)
      • modified residue (220)
      • modified residue (224)
      • modified residue (241)
      • modified residue (243)
      • modified residue (277)
      • modified residue (295)
      • modified residue (304)
      • modified residue (436)
    Domains in SCOPe 2.08: d2b4va1, d2b4va2
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4vA (A:)
    splslpstklnpspdhyavwgkaimaennrrvgpehmfrtairaqqqlqgladkwtpdak
    vyccgsmvtygqmergsdldlacmfddpypshevqakrtdklrtvikryvphylrnnllg
    lteartpvvklrfandekvararytplseeedrkartalldvrnqcvgdndveyiaekmg
    rdnvegirvdrttygcriaiqctskeqmieaigffpdgkimtrgmredytrdvldvrfvp
    emfmyrwdisfvgygvknsylirhylhngpvaarhtamavkawgkatnvgagsgamltsy
    avtvmfiyyllvtrqvlwvdpwslphpahlprypdfsplydcdptelgrllhgffifyah
    hfdyerevvslnrnrrsyrsdigwnfpqnkkgtfsynfciedpyedvgtgglnlvrhlhp
    akfqlvkqeflraaqcmerflptnapeksilgvkradlrhferdrdre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4vA (A:)
    npspdhyavwgkaimaennrrvgpehmfrtairaqqqlqgladkwtpdakvyccgsmvty
    gqmergsdldlacmfddpypshevqakrtdklrtvikryvphylrnnllglteartpvvk
    lrfandekvararytplseeedrkartalldvrnqcvgdndveyiaekmgrdnvegirvd
    rttygcriaiqctskeqmieaigffpdgkimtrgmredytrdvldvrfvpemfmyrwdis
    fvgygvknsylirhylhngpvaarhtamavkawgkatngamltsyavtvmfiyyllvtrq
    vlwvdpwslphpahlprypdfsplydcdptelgrllhgffifyahhfdyerevvslnrnr
    rsyrsdigwnfpqnkkgtfsynfciedpyedvgtgglnlvrhlhpakfqlvkqeflraaq
    cmerflptnapeksilg