PDB entry 2b4r

View 2b4r on RCSB PDB site
Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 Angstrom Resolution reveals intriguing extra electron density in the active site
Class: oxidoreductase
Keywords: SGPP, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, GAPDH, GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, Structural Genomics of Pathogenic Protozoa Consortium, OXIDOREDUCTASE
Deposited on 2005-09-26, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PF14_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6B1
      • engineered (10)
      • engineered (343)
    Domains in SCOPe 2.07: d2b4ro1, d2b4ro2, d2b4ro3, d2b4ro4
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PF14_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6B1
      • engineered (10)
      • engineered (343)
    Domains in SCOPe 2.07: d2b4rp1, d2b4rp2, d2b4rp3, d2b4rp4
  • Chain 'Q':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PF14_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6B1
      • engineered (10)
      • engineered (343)
    Domains in SCOPe 2.07: d2b4rq1, d2b4rq2, d2b4rq3, d2b4rq4
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PF14_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6B1
      • engineered (10)
      • engineered (343)
    Domains in SCOPe 2.07: d2b4rr1, d2b4rr2, d2b4rr3, d2b4rr4
  • Heterogens: NAD, AES, GOL, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2b4rO (O:)
    mahhhhhhmaatklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsv
    hgqfpcevthadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshl
    kggakkvimsappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiv
    eglmttvhastanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngklt
    gvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhd
    nrssifdmkaglalndnffklvswydnewgysnrvldlavhitts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4rO (O:)
    atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
    adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
    appkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhas
    tanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpigt
    vsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdmka
    glalndnffklvswydnewgysnrvldlavhitt
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2b4rP (P:)
    mahhhhhhmaatklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsv
    hgqfpcevthadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshl
    kggakkvimsappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiv
    eglmttvhastanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngklt
    gvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhd
    nrssifdmkaglalndnffklvswydnewgysnrvldlavhitts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4rP (P:)
    atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
    adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
    appkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhas
    tanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpigt
    vsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdmka
    glalndnffklvswydnewgysnrvldlavhitt
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2b4rQ (Q:)
    mahhhhhhmaatklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsv
    hgqfpcevthadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshl
    kggakkvimsappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiv
    eglmttvhastanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngklt
    gvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhd
    nrssifdmkaglalndnffklvswydnewgysnrvldlavhitts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4rQ (Q:)
    atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
    adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
    appkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhas
    tanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpigt
    vsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdmka
    glalndnffklvswydnewgysnrvldlavhitt
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2b4rR (R:)
    mahhhhhhmaatklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsv
    hgqfpcevthadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshl
    kggakkvimsappkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiv
    eglmttvhastanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngklt
    gvafrvpigtvsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhd
    nrssifdmkaglalndnffklvswydnewgysnrvldlavhitts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4rR (R:)
    atklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevth
    adgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvims
    appkddtpiyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhas
    tanqlvvdgpskggkdwragrcalsniipastgaakavgkvlpelngkltgvafrvpigt
    vsvvdlvcrlqkpakyeevaleikkaaegplkgilgytedevvsqdfvhdnrssifdmka
    glalndnffklvswydnewgysnrvldlavhitt