PDB entry 2b4j

View 2b4j on RCSB PDB site
Description: Structural basis for the recognition between HIV-1 integrase and LEDGF/p75
Class: viral protein, recombination
Keywords: HIV, integration, transcription, viral protein, recombination
Deposited on 2005-09-24, released 2005-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrase (IN)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered (138)
    Domains in SCOPe 2.08: d2b4ja_
  • Chain 'B':
    Compound: Integrase (IN)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered (138)
    Domains in SCOPe 2.08: d2b4jb_
  • Chain 'C':
    Compound: PC4 and SFRS1 interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PSIP1, LEDGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75475 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2b4jc1, d2b4jc2
  • Chain 'D':
    Compound: PC4 and SFRS1 interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PSIP1, LEDGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75475 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2b4jd2, d2b4jd3
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4jA (A:)
    gshmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklag
    rwpvktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvr
    dqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4jA (A:)
    cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
    dngsnftsttvkaacwwagikqefviesmnkelkkiigqvrdqaehlktavqmavfihnk
    ksagerivdiiatdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b4jB (B:)
    gshmhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklag
    rwpvktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvr
    dqaehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4jB (B:)
    spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
    ngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
    qmavfihnkkrsagerivdiiatdi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b4jC (C:)
    gssmdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkir
    rfkvsqvimekstmlynkfknmflvgegdsvitqvlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4jC (C:)
    gssmdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkir
    rfkvsqvimekstmlynkfknm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b4jD (D:)
    gssmdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkir
    rfkvsqvimekstmlynkfknmflvgegdsvitqvlnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4jD (D:)
    gssmdsrlqrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkir
    rfkvsqvimekstmlynkfknm