PDB entry 2b4f

View 2b4f on RCSB PDB site
Description: Structure Of A Cold-Adapted Family 8 Xylanase in complex with substrate
Class: Hydrolase
Keywords: hydrolase, xylan degradation, psychrophilic, cold adaptation, temperature, glycosyl hydrolase, family 8
Deposited on 2005-09-23, released 2006-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-18, with a file datestamp of 2015-03-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RJN8 (0-End)
      • engineered (143)
    Domains in SCOPe 2.06: d2b4fa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4fA (A:)
    afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
    ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
    vyawklklnqngfvykvdegpapageeyfafallnasarwgnsgefnyyndaitmlntik
    nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
    tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
    whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
    aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4fA (A:)
    afnnnpssvgayssgtyrnlaqemgktniqqkvnstfdnmfgynntqqlyypytengvyk
    ahyikainpdegddirtegqswgmtaavmlnkqeefdnlwrfakayqknpdnhpdakkqg
    vyawklklnqngfvykvdegpapageeyfafallnasarwgnsgefnyyndaitmlntik
    nklmenqiirfspyidnltdpsyhipafydyfannvtnqadknywrqvatksrtllknhf
    tkvsgsphwnlptflsrldgspvigyifngqanpgqwyefdawrvimnvgldahlmgaqa
    whksavnkalgflsyaktnnskncyeqvysyggaqnrgcagegqkaanavallastnagq
    aneffnefwslsqptgdyryyngslymlamlhvsgnfkfynntf