PDB entry 2b4d

View 2b4d on RCSB PDB site
Description: SSAT+COA+SP- SP disordered
Class: transferase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2005-09-23, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b4da_
  • Chain 'B':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b4db_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4dA (A:)
    makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4dA (A:)
    akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
    ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
    cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b4dB (B:)
    makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4dB (B:)
    akfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpk
    ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
    cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee