PDB entry 2b4b

View 2b4b on RCSB PDB site
Description: SSAT+COA+BE-3-3-3, K6R mutant
Class: transferase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2005-09-23, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21673 (Start-170)
      • engineered mutation (25)
    Domains in SCOPe 2.07: d2b4ba_
  • Chain 'B':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21673 (Start-170)
      • engineered mutation (25)
    Domains in SCOPe 2.07: d2b4bb_
  • Heterogens: COA, B33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4bA (A:)
    makfvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4bA (A:)
    fvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevpkeh
    wtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcs
    smhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b4bB (B:)
    makfvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4bB (B:)
    akfvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevpk
    ehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcr
    cssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee