PDB entry 2b4a

View 2b4a on RCSB PDB site
Description: Crystal structure of a response regulator receiver domain protein (bh3024) from bacillus halodurans c-125 at 2.42 A resolution
Class: signaling protein
Keywords: Flavodoxin-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, signaling protein
Deposited on 2005-09-23, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.182
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bh3024
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: 10175646
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b4aa1
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4aA (A:)
    mgsdkihhhhhhmqpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlst
    cdllivsdqlvdlsifslldivkeqtkqpsvlilttgrheliessehnlsylqkpfaise
    lraaidyhkpsmgvtmnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4aA (A:)
    qpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlstcdllivsdqlvdl
    sifslldivkeqtkqpsvlilttgrliessehnlsylqkpfaiselraaidyhkps