PDB entry 2b42

View 2b42 on RCSB PDB site
Description: Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase
Class: hydrolase inhibitor/hydrolase
Keywords: protein-protein complex; two beta-barrel domain; beta-jelly roll; x-ray crystallography, HYDROLASE INHIBITOR-HYDROLASE COMPLEX
Deposited on 2005-09-22, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase inhibitor-I
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • GB CAD27730 (0-380)
      • conflict (39)
      • conflict (273)
    Domains in SCOPe 2.07: d2b42a1
  • Chain 'B':
    Compound: Endo-1,4-beta-xylanase A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xynA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18429 (Start-184)
      • conflict (146)
    Domains in SCOPe 2.07: d2b42b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b42A (A:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstckggqppaeipcssptcllana
    ypapgcpapscgsdkhdkpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgv
    laacapskllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgg
    gpvpwpqftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpy
    vllrpdvyrplmdaftkalaaqhangapvaravvavapfgvcydtktlgnnlggyavpnv
    qlgldggsdwtmtgknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldf
    dmekkrlgfsrlphftgcggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b42A (A:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstckgeipcssptcllanaypapg
    cpakpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgvlaacapskllaslp
    rgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgggpvpwpqftqsmpy
    tplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpyvllrpdvyrplmda
    ftkalaaqgapvaravvavapfgvcydtktlgnnlggyavpnvqlgldggsdwtmtgkns
    mvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldfdmekkrlgfsrlphftg
    cggl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b42B (B:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b42B (B:)
    stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
    gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
    rttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgssn
    vtvw