PDB entry 2b3w

View 2b3w on RCSB PDB site
Description: NMR structure of the E.coli protein YbiA, Northeast Structural Genomics target ET24.
Class: structural genomics, unknown function
Keywords: ET24, NMR structure, NESG, Structural Genomics, YbiA, COG 3236, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2005-09-21, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ybiA
    Species: Escherichia coli [TaxId:562]
    Gene: ybiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30176 (0-159)
      • cloning artifact (160-161)
      • expression tag (162-167)
    Domains in SCOPe 2.08: d2b3wa1, d2b3wa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b3wA (A:)
    mpvraqriqhvmqdtiinfystsddygdfsnfaawpikvdgktwptsehyfqaqkfldek
    yreeirrvsspmvaarmgrdrskplrknwesvkeqvmrkalrakfeqhaelralllatap
    aklvehtendaywgdgghgkgknrlgyllmelreqlaieklehhhhhh