PDB entry 2b3u

View 2b3u on RCSB PDB site
Description: Human Spermine spermidine acetyltransferase K26R mutant
Class: transferase
Keywords: Acyltransferase, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2005-09-21, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b3ua1
  • Chain 'B':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21673
      • engineered mutation (25)
    Domains in SCOPe 2.07: d2b3ub_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b3uA (A:)
    makfvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b3uA (A:)
    akfvirpataadcsdilrlikelaqviltekdlledgfgehpfyhclvaevpkehwtpeg
    hsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmhfl
    vaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b3uB (B:)
    makfvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b3uB (B:)
    fvirpataadcsdilrlikelaryeymeeqviltekdlledgfpfyhclvaevpkehwtp
    eghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmh
    flvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate