PDB entry 2b3t

View 2b3t on RCSB PDB site
Description: Molecular basis for bacterial class 1 release factor methylation by PrmC
Class: translation
Keywords: release factor; translation termination; methylation; conformational changes
Deposited on 2005-09-21, released 2006-01-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.244
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein methyltransferase hemK
    Species: Escherichia coli [TaxId:562]
    Gene: hemK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b3ta_
  • Chain 'B':
    Compound: Peptide chain release factor 1
    Species: Escherichia coli [TaxId:562]
    Gene: prfA, sueB, uar
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7I0
      • conflict (216)
    Domains in SCOPe 2.06: d2b3tb1
  • Heterogens: SAH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b3tA (A:)
    meyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldallt
    rrrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgt
    gaialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfami
    vsnppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgw
    qqgeavrqafilagyhdvetcrdygdnervtlgryy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b3tB (B:)
    mkpsivaklealherheevqallgdaqtiadqerfralsreyaqlsdvsrcftdwqqvqe
    dietaqmmlddpemremaqdelreakekseqleqqlqvlllpkdpddernaflevragtg
    gdeaalfagdlfrmysryaearrwrveimsasegehggykeiiakisgdgvygrlkfesg
    ghrvqrvpatesqgrihtsactvavmpelpdaelpdvnpadlridtfrssgaggqhvntt
    dsairithlptgivvecqdersqhknkakalsvlgarihaaemakrqqaeastrrnllgs
    gdrsdrnrtynfpqgrvtdhrinltlyrldevmegkldmliepiiqehqadqlaalseqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b3tB (B:)
    aklealherheevqallgdaqtiadqerfralsreyaqlsdvsrcftdwqqvqqlqvlll
    pkdpddernaflevragtggdeaalfagdlfrmysryaearrwrveimsasegehggyke
    iiakisgdgvygrlkfesgghrvqrvpatesqgrihtsactvavmpelpdaelpdvnpad
    lridtfrssgaggqhvnttdsairithlptgivvecqdersqhknkakalsvlgarihaa
    emakrqrrnsdrnrtynfpqgrvtdhrinltlyrldevmegkldmliepiiqehqadqla