PDB entry 2b3s

View 2b3s on RCSB PDB site
Description: structure of the DSBA mutant (P31G-C33A)
Class: oxidoreductase
Keywords: disulfide; thioredoxin; thiol-oxydase, OXIDOREDUCTASE
Deposited on 2005-09-21, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:83333]
    Gene: dsbA, dsf, ppfA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEG4
      • engineered (30)
      • engineered (32)
    Domains in SCOPe 2.07: d2b3sa_
  • Chain 'B':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:83333]
    Gene: dsbA, dsf, ppfA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEG4
      • engineered (30)
      • engineered (32)
    Domains in SCOPe 2.07: d2b3sb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b3sA (A:)
    aqyedgkqyttlekpvagapqvleffsffcghayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b3sA (A:)
    qyedgkqyttlekpvagapqvleffsffcghayqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylsek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b3sB (B:)
    aqyedgkqyttlekpvagapqvleffsffcghayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b3sB (B:)
    qyedgkqyttlekpvagapqvleffsffcghayqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylsek