PDB entry 2b3r

View 2b3r on RCSB PDB site
Description: Crystal structure of the C2 domain of class II phosphatidylinositide 3-kinase C2
Class: transferase
Keywords: C2 domain, lipid binding, PI3-kinase, TRANSFERASE
Deposited on 2005-09-20, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide
    Species: Mus musculus [TaxId:10090]
    Gene: Pik3c2a, Cpk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61194 (8-End)
      • cloning artifact (6-7)
    Domains in SCOPe 2.07: d2b3ra1, d2b3ra2
  • Chain 'B':
    Compound: Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide
    Species: Mus musculus [TaxId:10090]
    Gene: Pik3c2a, Cpk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61194 (8-End)
      • cloning artifact (6-7)
    Domains in SCOPe 2.07: d2b3rb1, d2b3rb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b3rA (A:)
    hhhhhhgsgavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrkt
    kisrktrnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsk
    etvkwyqltaatyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b3rA (A:)
    gsgavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrktkisrkt
    rnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsketvkwy
    qlta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b3rB (B:)
    hhhhhhgsgavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrkt
    kisrktrnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsk
    etvkwyqltaatyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b3rB (B:)
    gsgavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrktkisrkt
    rnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsketvkwy
    qlta