PDB entry 2b3m

View 2b3m on RCSB PDB site
Description: Crystal structure of protein AF1124 from Archaeoglobus fulgidus
Class: Structural Genomics, Unknown Function
Keywords: structural gemonics, Hypothetical protein, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Unknown Function
Deposited on 2005-09-20, released 2005-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein AF1124
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b3ma1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2b3mA (A:)
mgggevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglis
gdlnpvhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigd
vvrvegvvsgveknrytidvkcytgdkvvaegvvkvliw

    Sequence, based on observed residues (ATOM records): (download) 
    >2b3mA (A:)
vkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnp
vhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrve
gvvsgveknrytidvkcytgdkvvaegvvkvliw