PDB entry 2b3g

View 2b3g on RCSB PDB site
Description: p53N (fragment 33-60) bound to RPA70N
Class: Replication
Keywords: OB-fold, ssDNA mimicry, Replication
Deposited on 2005-09-20, released 2005-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.205
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RPA1, REPA1, RPA70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b3ga_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2b3gA (A:)
gshmvgqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
yne

    Sequence, based on observed residues (ATOM records): (download) 
    >2b3gA (A:)
mvgqlsegaiaaimqkgdtnikpilqvinirpitsppryrllmsdglntlssfmlatqln
plveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

  • Chain 'B':
    No sequence available.