PDB entry 2b3a

View 2b3a on RCSB PDB site
Description: Solution structure of the Ras-binding domain of the Ral Guanosine Dissociation Stimulator
Class: signaling protein
Keywords: Ras binding domain, ubiquitin fold, signal transduction, NMR, automatically solved, AUREMOL, SIGNALING PROTEIN
Deposited on 2005-09-20, released 2006-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ral guanine nucleotide dissociation stimulator
    Species: Homo sapiens [TaxId:9606]
    Gene: RALGDS, RGF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b3aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b3aA (A:)
    dcciirvsldvdngnmyksilvtsqdkapavirkamdkhnleeeepedyellqilsddrk
    lkipenanvfyamnstanydfvlkkrt