PDB entry 2b33

View 2b33 on RCSB PDB site
Description: Crystal structure of Protein synthesis inhibitor, putative (tm0215) from THERMOTOGA MARITIMA at 2.30 A resolution
Class: structural genomics, unknown function
Keywords: tm0215, Protein synthesis inhibitor, putative, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2005-09-19, released 2005-09-27
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein synthesis inhibitor, putative
    Species: Thermotoga maritima MSB8
    Gene: tm0215
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2b33a1
  • Chain 'B':
    Compound: protein synthesis inhibitor, putative
    Species: Thermotoga maritima MSB8
    Gene: tm0215
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2b33b1
  • Heterogens: CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b33A (A:)
    mgsdkihhhhhhmkrfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtie
    ektervlenlkaileaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvav
    aqlprnveieieaiavkege
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b33A (A:)
    mkrfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlka
    ileaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieie
    aiavkeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b33B (B:)
    mgsdkihhhhhhmkrfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtie
    ektervlenlkaileaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvav
    aqlprnveieieaiavkege
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b33B (B:)
    krfvetdkapkaigpysqavvvgnmmfvsgqipidpetgelvqgtieektervlenlkai
    leaggfslkdvvkvtvfttsmdyfqrvnevysryfgdhrparsfvavaqlprnveieiea
    iavkeg