PDB entry 2b30

View 2b30 on RCSB PDB site
Description: Initial Crystallographic Structural Analysis of a putative HAD/COF-like hydrolase from Plasmodium vivax
Class: structural genomics, unknown function
Keywords: SGPP, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, Structural Genomics of Pathogenic Protozoa Consortium
Deposited on 2005-09-19, released 2005-09-27
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pvivax hypothetical protein
    Species: Plasmodium vivax
    Domains in SCOP 1.75: d2b30a1
  • Chain 'B':
    Compound: Pvivax hypothetical protein
    Species: Plasmodium vivax
    Domains in SCOP 1.75: d2b30b1
  • Chain 'C':
    Compound: Pvivax hypothetical protein
    Species: Plasmodium vivax
    Domains in SCOP 1.75: d2b30c1
  • Chain 'D':
    Compound: Pvivax hypothetical protein
    Species: Plasmodium vivax
    Domains in SCOP 1.75: d2b30d1
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b30A (A:)
    mahhhhhhmadqnpdlkveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiek
    gymvsictgrskvgilsafgeenlkkmnfygmpgvyingtivydqigytlldetietdvy
    aelisylveknlvnqtifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmn
    klmivldpsesktvignlkqkfknkltifttynghaevtklghdkytginyllkhynisn
    dqvlvvgdaendiamlsnfkysfavanatdsakshakcvlpvshregavayllkkvfdlk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b30A (A:)
    kveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiekgymvsictgrskvgil
    safgeenlkkmnfygmpgvyingtivydqigytlldetietdvyaelisylveknlvnqt
    ifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmnklmivldpsesktvig
    nlkqkfknkltifttynghaevtklghdkytginyllkhynisndqvlvvgdaendiaml
    snfkysfavanatdsakshakcvlpvshregavayllkkvfdlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b30B (B:)
    mahhhhhhmadqnpdlkveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiek
    gymvsictgrskvgilsafgeenlkkmnfygmpgvyingtivydqigytlldetietdvy
    aelisylveknlvnqtifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmn
    klmivldpsesktvignlkqkfknkltifttynghaevtklghdkytginyllkhynisn
    dqvlvvgdaendiamlsnfkysfavanatdsakshakcvlpvshregavayllkkvfdlk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b30B (B:)
    kveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiekgymvsictgrskvgil
    safgeenlkkmnfygmpgvyingtivydqigytlldetietdvyaelisylveknlvnqt
    ifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmnklmivldpsesktvig
    nlkqkfknkltifttynghaevtklghdkytginyllkhynisndqvlvvgdaendiaml
    snfkysfavanatdsakshakcvlpvshregavayllkkvfdlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b30C (C:)
    mahhhhhhmadqnpdlkveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiek
    gymvsictgrskvgilsafgeenlkkmnfygmpgvyingtivydqigytlldetietdvy
    aelisylveknlvnqtifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmn
    klmivldpsesktvignlkqkfknkltifttynghaevtklghdkytginyllkhynisn
    dqvlvvgdaendiamlsnfkysfavanatdsakshakcvlpvshregavayllkkvfdlk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b30C (C:)
    kveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiekgymvsictgrskvgil
    safgeenlkkmnfygmpgvyingtivydqigytlldetietdvyaelisylveknlvnqt
    ifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmnklmivldpsesktvig
    nlkqkfknkltifttynghaevtklghdkytginyllkhynisndqvlvvgdaendiaml
    snfkysfavanatdsakshakcvlpvshregavayllkkvfdlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b30D (D:)
    mahhhhhhmadqnpdlkveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiek
    gymvsictgrskvgilsafgeenlkkmnfygmpgvyingtivydqigytlldetietdvy
    aelisylveknlvnqtifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmn
    klmivldpsesktvignlkqkfknkltifttynghaevtklghdkytginyllkhynisn
    dqvlvvgdaendiamlsnfkysfavanatdsakshakcvlpvshregavayllkkvfdlk
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b30D (D:)
    kveealkgadiklllidfdgtlfvdkdikvpsenidaikeaiekgymvsictgrskvgil
    safgeenlkkmnfygmpgvyingtivydqigytlldetietdvyaelisylveknlvnqt
    ifhrgesnyvtednkyadflqkmysenrsiiirhnemlkyrtmnklmivldpsesktvig
    nlkqkfknkltifttynghaevtklghdkytginyllkhynisndqvlvvgdaendiaml
    snfkysfavanatdsakshakcvlpvshregavayllkkvfdlk