PDB entry 2b2y

View 2b2y on RCSB PDB site
Description: Tandem chromodomains of human CHD1
Class: peptide binding protein
Keywords: CHD, Chromodomain, three stranded antiparallel Beta sheet, alpha helix linker
Deposited on 2005-09-19, released 2005-12-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: HOMO SAPIENS
    Gene: CHD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14646 (Start-184)
      • cloning artifact (185-186)
    Domains in SCOP 1.75: d2b2ya1, d2b2ya2
  • Chain 'B':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: HOMO SAPIENS
    Gene: CHD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14646 (Start-184)
      • cloning artifact (185)
    Domains in SCOP 1.75: d2b2yb1, d2b2yb2
  • Chain 'C':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: HOMO SAPIENS
    Gene: CHD1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2b2yc1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b2yA (A:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqq
    eltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacid
    eyfsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2yA (A:)
    efetierfmdcrigrkgatgatttiyaveadgdpnagfenkepgeiqylikwkgwshihn
    tweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqyqi
    vgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacideyfsrkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b2yB (B:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqq
    eltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacid
    eyfsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2yB (B:)
    eefetierfmdcrigrkgatgatttiyaveadgdpnagfekkepgeiqylikwkgwshih
    ntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqyq
    ivgriiahsnypdyyckwqglpysecswedgaliskkfqacideyfsrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b2yC (C:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedvey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2yC (C:)
    eefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshi
    hntweteetlkqqnvrgmkkldnykk