PDB entry 2b2w

View 2b2w on RCSB PDB site
Description: Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4
Class: peptide binding protein
Keywords: CHD, Chromodomain, three stranded antiparallel Beta sheet, alpha helix linker, histone H3, trimethyllysine
Deposited on 2005-09-19, released 2005-12-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: HOMO SAPIENS
    Gene: CHD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14646 (Start-184)
      • cloning artifact (185-186)
    Domains in SCOP 1.75: d2b2wa1, d2b2wa2
  • Chain 'B':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: HOMO SAPIENS
    Gene: CHD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14646 (Start-184)
      • cloning artifact (185)
    Domains in SCOP 1.75: d2b2wb1, d2b2wb2
  • Chain 'C':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: HOMO SAPIENS
    Gene: CHD1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2b2wc1
  • Chain 'D':
    Compound: histone h3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68431 (0-End)
      • modified residue (3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b2wA (A:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqq
    eltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacid
    eyfsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2wA (A:)
    eefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshi
    hntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqy
    qivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacideyfsrkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b2wB (B:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqq
    eltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacid
    eyfsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2wB (B:)
    eefetierfmdcrigrkgatgatttiyaveadgdpnagfekkepgeiqylikwkgwshih
    ntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqyq
    ivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacideyfsrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b2wC (C:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedvey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2wC (C:)
    eefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshi
    hntweteetlkqqnvrgmkkldnykk
    

  • Chain 'D':
    No sequence available.