PDB entry 2b2v

View 2b2v on RCSB PDB site
Description: Crystal structure analysis of human CHD1 chromodomains 1 and 2 bound to histone H3 resi 1-15 MeK4
Class: peptide binding protein
Keywords: CHD, Chromodomain, three stranded antiparallel Beta sheet, alpha helix linker, histone H3, monomethyllysine, PEPTIDE BINDING PROTEIN
Deposited on 2005-09-19, released 2005-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14646 (Start-184)
      • cloning artifact (185)
    Domains in SCOPe 2.07: d2b2va1, d2b2va2, d2b2va3
  • Chain 'B':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b2vb1, d2b2vb2
  • Chain 'C':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b2vc1
  • Chain 'D':
    Compound: histone h3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68431 (0-End)
      • modified residue (3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b2vA (A:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqq
    eltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacid
    eyfsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2vA (A:)
    efetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshih
    ntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqyq
    ivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacideyfsrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b2vB (B:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqq
    eltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacid
    eyfsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2vB (B:)
    fetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshihn
    tweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqyqi
    vgriiahsnqkgypdyyckwqglpysecswedgaliskkfqacideyfsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b2vC (C:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedvey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2vC (C:)
    fetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshihn
    tweteetlkqqnvrgmkkldnykkk
    

  • Chain 'D':
    No sequence available.