PDB entry 2b2t

View 2b2t on RCSB PDB site
Description: Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4 and phosphothreonine 3
Class: peptide binding protein
Keywords: CHD, Chromodomain, three stranded antiparallel Beta sheet, alpha helix linker, histone H3, trimethyllysine, phosphothreonine, PEPTIDE BINDING PROTEIN
Deposited on 2005-09-19, released 2005-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14646 (Start-184)
      • modified residue (19)
      • modified residue (87)
      • see remark 999 (177)
      • cloning artifact (185)
    Domains in SCOPe 2.07: d2b2ta1, d2b2ta2, d2b2ta3
  • Chain 'B':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14646 (9-184)
      • modified residue (19)
      • modified residue (87)
      • see remark 999 (177)
      • cloning artifact (185)
    Domains in SCOPe 2.07: d2b2tb1, d2b2tb2, d2b2tb3
  • Chain 'C':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14646
      • modified residue (19)
      • modified residue (87)
    Domains in SCOPe 2.07: d2b2tc1
  • Chain 'D':
    Compound: Histone H3 tail
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68431 (0-End)
      • modified residue (2-3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b2tA (A:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqq
    eltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqamid
    eyfsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2tA (A:)
    eefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshi
    hntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqy
    qivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqamideyfsrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b2tB (B:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqq
    eltddlhkqyqivgriiahsnqksaagypdyyckwqglpysecswedgaliskkfqamid
    eyfsrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2tB (B:)
    eeefetierfmdcrigrkgatgatttiyaveadgdpnagfekkepgeiqylikwkgwshi
    hntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqy
    qivgriiahsnqksgypdyyckwqglpysecswedgaliskkfqamideyfsrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b2tC (C:)
    mkkhhhhhheeefetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqy
    likwkgwshihntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedvey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2tC (C:)
    efetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshih
    ntweteetlkqqnvrgmkkldnykkk
    

  • Chain 'D':
    No sequence available.