PDB entry 2b2n

View 2b2n on RCSB PDB site
Description: Structure of transcription-repair coupling factor
Class: transcription, DNA repair
Keywords: x-ray crystallography; strand-specific repair; template strand; RNA polymerase; RNAP; uvrA/B/C repair system
Deposited on 2005-09-19, released 2006-01-24
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription-repair coupling factor
    Species: Escherichia coli
    Gene: mfd
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2b2na1
  • Chain 'B':
    Compound: Transcription-repair coupling factor
    Species: Escherichia coli
    Gene: mfd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30958 (Start-332)
      • his tag (333)
    Domains in SCOP 1.75: d2b2nb1
  • Heterogens: NA, SO4, P4C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b2nA (A:)
    mpeqyrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhdeis
    qftdqmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrvcph
    sflhghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgselpy
    rldffddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfevkrd
    pehiyqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqadtl
    arfenrgvdpmrpllppqslwlrvdelfselknaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2nA (A:)
    acatlvaeiaerhagpvvliapdmqnalrlhdeisqftdqmvmnladwetlpydsfsphq
    diissrlstlyqlptmqrgvlivpvntlmqrvcphsflhghalvmkkgqrlsrdalrtql
    dsagyrhvdqvmehgeyatrgalldlfpmgselpyrldffddeidslrvfdvdsqrtlee
    veainllpahefptdkaaielfrsqwrdtfevkrdpehiyqqvskgtlpagieywqplff
    seplpplfsyfpantllvntgdletsaerfqadtlarfenrgvdpmrpllppqslwlrvd
    elfselkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b2nB (B:)
    mpeqyrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhdeis
    qftdqmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrvcph
    sflhghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgselpy
    rldffddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfevkrd
    pehiyqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqadtl
    arfenrgvdpmrpllppqslwlrvdelfselknaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2nB (B:)
    acatlvaeiaerhagpvvliapdmqnalrlhdeisqftdqmvmnladwetlpydsfsphq
    diissrlstlyqlptmqrgvlivpvntlmqrvcphsflhghalvmkkgqrlsrdalrtql
    dsagyrhvdqvmehgeyatrgalldlfpmgselpyrldffddeidslrvfdvdsqrtlee
    veainllpahefptdkaaielfrsqwrdtfevkrdpehiyqqvskgtlpagieywqplff
    seplpplfsyfpantllvntgdletsaerfqadtlarfenrgvdpmrpllppqslwlrvd
    elfselkna