PDB entry 2b2m

View 2b2m on RCSB PDB site
Description: Solution structure for the protein coded by gene locus BB0938 of Bordetella bronchiseptica. Northeast Structural Genomics target BoR11.
Class: structural genomics, unknown function
Keywords: Beta barrel containing fold; AutoStructure; AutoAssign; NMR structure; BoR11 , Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2005-09-19, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2005-11-15, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein BoR11
  Species: Bordetella bronchiseptica
  Gene: BB0938
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WNU7 (0-119)
    • conflict (94)
    • his tag (120-129)
  Domains in SCOPe 2.08: d2b2ma1, d2b2ma2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2b2mA (A:)
  msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlk
  apgmlrldipldviedddsvryqmlvgeqtvdvveegelaaawisnhagvpcrilkvhpd
  maevrwpslehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2b2mA (A:)
  msttayqpiaecgattqseaaayqkrwlvandagqwlnrdlcprlaevsvelrmgylvlk
  apgmlrldipldviedddsvryqmlvgeqtvdvveegelaaawisnhagvpcrilkvhpd
  maevrwpsle