PDB entry 2b2d

View 2b2d on RCSB PDB site
Description: RNA stemloop operator from bacteriophage QBETA complexed with an N87S,E89K mutant MS2 capsid
Class: virus/viral protein/RNA
Keywords: capsid, complex (capsid protein - RNA hairpin) hairpin, levivirus, VIRUS/VIRAL, protein/RNA, VIRUS-VIRAL PROTEIN-RNA COMPLEX
Deposited on 2005-09-19, released 2006-05-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.197
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (86)
      • engineered (88)
    Domains in SCOPe 2.01: d2b2da_
  • Chain 'B':
    Compound: coat protein
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (86)
      • engineered (88)
    Domains in SCOPe 2.01: d2b2db_
  • Chain 'C':
    Compound: coat protein
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (86)
      • engineered (88)
    Domains in SCOPe 2.01: d2b2dc_
  • Chain 'R':
    Compound: 5'-r(*ap*up*gp*cp*ap*up*gp*up*cp*up*ap*ap*gp*ap*cp*ap*gp*cp*ap*u)-3'
  • Chain 'S':
    Compound: 5'-r(*ap*up*gp*cp*ap*up*gp*up*cp*up*ap*ap*gp*ap*cp*ap*gp*cp*ap*u)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b2dA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylsmkltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b2dB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylsmkltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b2dC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylsmkltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.