PDB entry 2b2c

View 2b2c on RCSB PDB site
Description: Cloning, expression, characterisation and three- dimensional structure determination of the Caenorhabditis elegans spermidine synthase
Class: transferase
Keywords: beta-alpha, TRANSFERASE
Deposited on 2005-09-19, released 2005-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spermidine synthase
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b2ca1
  • Chain 'B':
    Compound: spermidine synthase
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b2cb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b2cA (A:)
    mnklhkgwftefspddlekmngasdeeptkvlksdgqemggawpgqafslqvkkvlfhek
    skyqdvlvfesttygnvlvldgivqaterdefsyqemlahlpmfahpdpkrvliigggdg
    gilrevlkhesvekvtmceidemvidvakkflpgmscgfshpkldlfcgdgfeflknhkn
    efdviitdssdpvgpaeslfgqsyyellrdalkedgilssqgesvwlhlpliahlvafnr
    kifpavtyaqsivstypsgsmgylicaknanrdvttpartltaeqikalnlrfynsevhk
    aafvlpqfvknale
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2cA (A:)
    klhkgwftefspddlgawpgqafslqvkkvlfhekskyqdvlvfesttygnvlvldgivq
    aterdefsyqemlahlpmfahpdpkrvliigggdggilrevlkhesvekvtmceidemvi
    dvakkflpgmscgfshpkldlfcgdgfeflknhknefdviitdssyyellrdalkedgil
    ssqgesvwlhlpliahlvafnrkifpavtyaqsivstypsgsmgylicaknanrdvttpa
    rtltaeqikalnlrfynsevhkaafvlpqfvknale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b2cB (B:)
    mnklhkgwftefspddlekmngasdeeptkvlksdgqemggawpgqafslqvkkvlfhek
    skyqdvlvfesttygnvlvldgivqaterdefsyqemlahlpmfahpdpkrvliigggdg
    gilrevlkhesvekvtmceidemvidvakkflpgmscgfshpkldlfcgdgfeflknhkn
    efdviitdssdpvgpaeslfgqsyyellrdalkedgilssqgesvwlhlpliahlvafnr
    kifpavtyaqsivstypsgsmgylicaknanrdvttpartltaeqikalnlrfynsevhk
    aafvlpqfvknale
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b2cB (B:)
    klhkgwftefspddlgawpgqafslqvkkvlfhekskyqdvlvfesttygnvlvldgivq
    aterdefsyqemlahlpmfahpdpkrvliigggdggilrevlkhesvekvtmceidemvi
    dvakkflpgmscgfshpkldlfcgdgfeflknhknefdviitdssyyellrdalkedgil
    ssqgesvwlhlpliahlvafnrkifpavtyaqsivstypsgsmgylicaknanrdvttpa
    rtltaeqikalnlrfynsevhkaafvlpqfvknale