PDB entry 2b29

View 2b29 on RCSB PDB site
Description: N-terminal domain of the RPA70 subunit of human replication protein A.
Class: replication
Keywords: replication
Deposited on 2005-09-18, released 2005-10-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.22
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: HOMO SAPIENS
    Gene: RPA1, REPA1, RPA70
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b29a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2b29A (A:)
gshmvgqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfm
latqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvp
yne

    Sequence, based on observed residues (ATOM records): (download) 
    >2b29A (A:)
gqlsegaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlatql
nplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne