PDB entry 2b26

View 2b26 on RCSB PDB site
Description: The crystal structure of the protein complex of yeast Hsp40 Sis1 and Hsp70 Ssa1
Class: chaperone/protein transport
Keywords: Hsp40 Sis1 Hsp70 Ssa1, CHAPERONE/PROTEIN TRANSPORT COMPLEX
Deposited on 2005-09-16, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.276
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SIS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25294 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2b26a1, d2b26a2, d2b26a3
  • Chain 'B':
    Compound: SIS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25294 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2b26b1, d2b26b2, d2b26b3
  • Chain 'C':
    Compound: SIS1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SIS1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Heat shock 70 kDa protein cognate 2
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Hsc70-2, Hsc2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b26A (A:)
    etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdy
    npqtgrrktlqfviqekshpnfkrdgddliytlplsfkesllgfsktiqtidgrtlplsr
    vqpvqpsqtstypgqgmptpknpsqrgnlivkykvdypislndaqkraidenf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b26A (A:)
    etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkitrktlqfv
    iqekshpnfkrdgddliytlplsfkesllgfsktiqtidgrtlplsrvqpvqpsqtstyp
    gqgmptpknpsqrgnlivkykvdypislndaqkraid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b26B (B:)
    etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdy
    npqtgrrktlqfviqekshpnfkrdgddliytlplsfkesllgfsktiqtidgrtlplsr
    vqpvqpsqtstypgqgmptpknpsqrgnlivkykvdypislndaqkraidenf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b26B (B:)
    etvqvnlpvsledlfvgkkksfktqidiqlkpgwkagtkityknktlqfviqekshpnfk
    rdgddliytlplsfkesllgfsktiqtidgrtlplsrvqpvqpsqtstypgqgmptpknp
    sqrgnlivkykvdypislndaqkraid
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.