PDB entry 2b1u

View 2b1u on RCSB PDB site
Description: Solution structure of Calmodulin-like Skin Protein C terminal domain
Class: metal binding protein
Keywords: CLSP, Calmodulin-like skin protein, NMR, Solution structure, Backbone dynamic, Structural Genomics, Structural Proteomics in Europe, SPINE, METAL BINDING PROTEIN
Deposited on 2005-09-16, released 2006-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin-like protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CALML5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b1ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b1uA (A:)
    aragledlqvafrafdqdgdghitvdelrramaglgqplpqeeldamireadvdqdgrvn
    yeefarmlaqe