PDB entry 2b1r

View 2b1r on RCSB PDB site
Description: X-ray structure of the sucrose-phosphatase (SPP) from Synechocystis sp.PCC6803 in complex with cellobiose
Class: Hydrolase
Keywords: phosphohydrolase, HAD superfamily, cellobiose, cyanobacteria, Hydrolase
Deposited on 2005-09-16, released 2006-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein slr0953
    Species: Synechocystis sp. [TaxId:1148]
    Gene: spp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b1ra_
  • Heterogens: CBI, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b1rA (A:)
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls