PDB entry 2b17

View 2b17 on RCSB PDB site
Description: Specific binding of non-steroidal anti-inflammatory drugs (NSAIDs) to phospholipase A2: Crystal structure of the complex formed between phospholipase A2 and diclofenac at 2.7 A resolution:
Class: Hydrolase
Keywords: drugs, binding, complex, inhibiton, Hydrolase
Deposited on 2005-09-15, released 2005-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.192
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
  Domains in SCOPe 2.08: d2b17a_
• Heterogens: SO4, DIF, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2b17A (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c