PDB entry 2b12

View 2b12 on RCSB PDB site
Description: Crystal structure of the protein-protein complex between F82Y cytochrome c and cytochrome c peroxidase
Class: oxidoreductase/electron transport
Keywords: cytochrome, electron transfer
Deposited on 2005-09-15, released 2005-10-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.277
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c peroxidase, mitochondrial
  Species: Saccharomyces cerevisiae
  Gene: CCP1, CCP, CPO
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00431 (0-293)
  Domains in SCOP 1.73: d2b12a1
• Chain 'B':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae
  Gene: CYC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • engineered (86)
• Heterogens: ZNH, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2b12A (A:)
  ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
  dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
  gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
  hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
  dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
  

  
  
• Chain 'B':
  No sequence available.