PDB entry 2b12

View 2b12 on RCSB PDB site
Description: Crystal structure of the protein-protein complex between F82Y cytochrome c and cytochrome c peroxidase
Class: oxidoreductase/electron transport
Keywords: cytochrome, electron transfer, OXIDOREDUCTASE-ELECTRON TRANSPORT COMPLEX
Deposited on 2005-09-15, released 2005-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c peroxidase, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP1, CCP, CPO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b12a_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered (86)
    Domains in SCOPe 2.08: d2b12b1
  • Heterogens: ZNH, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b12A (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b12B (B:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmaygglkkekdrndlitylkkace