PDB entry 2b0v

View 2b0v on RCSB PDB site
Description: NUDIX hydrolase from Nitrosomonas europaea.
Class: unknown function
Keywords: structural genomics, NUDIX hydrolase , PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-09-14, released 2005-09-27
The last revision prior to the SCOP 1.75 freeze date was dated 2005-09-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.168
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NUDIX hydrolase
    Species: Nitrosomonas europaea
    Gene: NE0184
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82XR9 (Start-150)
      • modified residue (122)
      • modified residue (129)
      • cloning artifact (151-152)
    Domains in SCOP 1.75: d2b0va1
  • Heterogens: CL, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b0vA (A:)
    ghmtwkpnvtvaavieqddkyllveeiprgtaiklnqpaghlepgesiiqacsrevleet
    ghsflpevltgiyhwtcasngttylrftfsgqvvsfdpdrkldtgivraawfsideirak
    qamhrtplvmqciedyhagkrypldilqyydgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0vA (A:)
    kpnvtvaavieqddkyllveeiprgtaiklnqpaghlepgesiiqacsrevleetghsfl
    pevltgiyhwtcasngttylrftfsgqvvsfdpdrkldtgivraawfsideirakqamhr
    tplvmqciedyhagkrypldilqyydgs