PDB entry 2b0o

View 2b0o on RCSB PDB site
Description: Crystal structure of UPLC1 GAP domain
Class: metal binding protein
Keywords: ARFGAP, Structural Genomics, Structural Genomics Consortium, SGC, METAL BINDING PROTEIN
Deposited on 2005-09-14, released 2005-09-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: uplc1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDEFL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2b0oe1, d2b0oe2
  • Chain 'F':
    Compound: uplc1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDEFL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2b0of1, d2b0of2
  • Chain 'G':
    Compound: uplc1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDEFL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2b0og1, d2b0og2
  • Chain 'H':
    Compound: uplc1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDEFL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2b0oh1, d2b0oh2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2b0oE (E:)
    mgsshhhhhhssglvprgsghdgephdltklliaevksrpgnsqccdcgaadptwlstnl
    gvltciqcsgvhrelgvrfsrmqsltldllgpselllalnmgntsfnevmeaqlpshggp
    kpsaesdmgtrrdyimakyvehrfarrctpepqrlwtaicnrdllsvleafangqdfgqp
    lpgpdaqapeelvlhlavkvanqaslplvdfiiqngghldakaadgntalhyaalynqpd
    clklllkgralvgtvneagetaldiarkkhhkeceelleqaqagtfafplhvdyswvist
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0oE (E:)
    dltklliaevksrpgnsqccdcgaadptwlstnlgvltciqcsgvhrelgvrfsrmqslt
    ldllgpselllalnmgntsfnevmeaqlpshggpkpsaesdmgtrrdyimakyvehrfar
    rctepqrlwtaicnrdllsvleafangqdfgqplpgpdaqapeelvlhlavkvanqaslp
    lvdfiiqngghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiar
    kkhhkeceelleqaqagtfafplh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2b0oF (F:)
    mgsshhhhhhssglvprgsghdgephdltklliaevksrpgnsqccdcgaadptwlstnl
    gvltciqcsgvhrelgvrfsrmqsltldllgpselllalnmgntsfnevmeaqlpshggp
    kpsaesdmgtrrdyimakyvehrfarrctpepqrlwtaicnrdllsvleafangqdfgqp
    lpgpdaqapeelvlhlavkvanqaslplvdfiiqngghldakaadgntalhyaalynqpd
    clklllkgralvgtvneagetaldiarkkhhkeceelleqaqagtfafplhvdyswvist
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0oF (F:)
    ltklliaevksrpgnsqccdcgaadptwlstnlgvltciqcsgvhrelgvrfsrmqsltl
    dllgpselllalnmgntsfnevmeaqlpshggpkpsaesdmgtrrdyimakyvehrfarr
    ctpqrlwtaicnrdllsvleafangqdfgqplpgeelvlhlavkvanqaslplvdfiiqn
    gghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkhhkece
    elleqaqagtfafplhvdyswviste
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2b0oG (G:)
    mgsshhhhhhssglvprgsghdgephdltklliaevksrpgnsqccdcgaadptwlstnl
    gvltciqcsgvhrelgvrfsrmqsltldllgpselllalnmgntsfnevmeaqlpshggp
    kpsaesdmgtrrdyimakyvehrfarrctpepqrlwtaicnrdllsvleafangqdfgqp
    lpgpdaqapeelvlhlavkvanqaslplvdfiiqngghldakaadgntalhyaalynqpd
    clklllkgralvgtvneagetaldiarkkhhkeceelleqaqagtfafplhvdyswvist
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0oG (G:)
    phdltklliaevksrpgnsqccdcgaadptwlstnlgvltciqcsgvhrelgvrfsrmqs
    ltldllgpselllalnmgntsfnevmeaqlpshggpkpsaesdmgtrrdyimakyvehrf
    arrpepqrlwtaicnrdllsvleafangqdfgqplpgeelvlhlavkvanqaslplvdfi
    iqngghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkhhk
    eceelleqaqagt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2b0oH (H:)
    mgsshhhhhhssglvprgsghdgephdltklliaevksrpgnsqccdcgaadptwlstnl
    gvltciqcsgvhrelgvrfsrmqsltldllgpselllalnmgntsfnevmeaqlpshggp
    kpsaesdmgtrrdyimakyvehrfarrctpepqrlwtaicnrdllsvleafangqdfgqp
    lpgpdaqapeelvlhlavkvanqaslplvdfiiqngghldakaadgntalhyaalynqpd
    clklllkgralvgtvneagetaldiarkkhhkeceelleqaqagtfafplhvdyswvist
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0oH (H:)
    ltklliaevksrpgnsqccdcgaadptwlstnlgvltciqcsgvhrelgvrfsrmqsltl
    dllgpselllalnmgntsfnevmeaqlpshggpkpsaesdmgtrrdyimakyvehrfarr
    epqrlwtaicnrdllsvleafangqdfgqplpgeelvlhlavkvanqaslplvdfiiqng
    ghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkhhkecee
    lleqaqagtfafplhvdyswvi