PDB entry 2b0l

View 2b0l on RCSB PDB site
Description: C-terminal DNA binding domain of transcriptional pleiotropic repressor CodY.
Class: DNA binding protein
Keywords: CodY, DNA-binding; Nucleotide-binding; Repressor; Transcription regulation; Winged HTH motif., DNA BINDING PROTEIN
Deposited on 2005-09-14, released 2006-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-sensing transcriptional pleiotropic repressor codY
    Species: Bacillus subtilis [TaxId:1423]
    Gene: codY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39779 (10-End)
      • expression tag (3-8)
      • initiating methionine (9)
    Domains in SCOPe 2.08: d2b0la1, d2b0la2
  • Chain 'B':
    Compound: GTP-sensing transcriptional pleiotropic repressor codY
    Species: Bacillus subtilis [TaxId:1423]
    Gene: codY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39779 (10-End)
      • expression tag (5-8)
      • initiating methionine (9)
    Domains in SCOPe 2.08: d2b0lb2, d2b0lb3
  • Chain 'C':
    Compound: GTP-sensing transcriptional pleiotropic repressor codY
    Species: Bacillus subtilis [TaxId:1423]
    Gene: codY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39779 (10-End)
      • expression tag (5-8)
      • initiating methionine (9)
    Domains in SCOPe 2.08: d2b0lc2, d2b0lc3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b0lA (A:)
    gsshhhhhhmskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvi
    vnalrklesagviesrslgmkgtyikvlnnkflielenlksh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0lA (A:)
    hhhhhhmskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvivna
    lrklesagviesrslgmkgtyikvlnnkflielenlks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b0lB (B:)
    gsshhhhhhmskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvi
    vnalrklesagviesrslgmkgtyikvlnnkflielenlksh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0lB (B:)
    hhhhmskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvivnalr
    klesagviesrslgmkgtyikvlnnkflielenlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b0lC (C:)
    gsshhhhhhmskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvi
    vnalrklesagviesrslgmkgtyikvlnnkflielenlksh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0lC (C:)
    hhhhmskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvivnalr
    klesagviesrslgmkgtyikvlnnkflielenl