PDB entry 2b0j

View 2b0j on RCSB PDB site
Description: The crystal structure of the apoenzyme of the iron-sulfur-cluster-free hydrogenase (Hmd)
Class: oxidoreductase
Keywords: Rossmann fold, helix bundle, OXIDOREDUCTASE
Deposited on 2005-09-14, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-methenyltetrahydromethanopterin hydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b0ja1, d2b0ja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b0jA (A:)
    mkiailgagcyrthaaagitnfmracevakevgkpeialthssitygaellhlvpdvkev
    ivsdpcfaeepglvvidefdpkevmeahlsgnpesimpkirevvkakakelpkppkacih
    lvhpedvglkvtsddreavegadivitwlpkgnkqpdiikkfadaipegaivthactipt
    tkfakifkdlgredlnitsyhpgcvpemkgqvyiaegyaseeavnklyeigkiargkafk
    mpanligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkek
    gianmeealdpaallgtadsmcfgplaeilptalkvlekhkvveeegktkceimsqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b0jA (A:)
    mkiailgagcyrthaaagitnfmracevakevgkpeialthssitygaellhlvpdvkev
    ivsdpcfaeepglvvidefdpkevmeahlsgnpesimpkirevvkakakelpkppkacih
    lvhpedvglkvtsddreavegadivitwlpkgnkqpdiikkfadaipegaivthactipt
    tkfakifkdlgredlnitsyhpgcvpemkgqvyiaegyaseeavnklyeigkiargkafk
    mpanligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkek
    gianmeealdpaallgtadsmcfgplaeilptalkvlekhkvve