PDB entry 2b0h

View 2b0h on RCSB PDB site
Description: Solution structure of VBS3 fragment of talin
Class: structural protein
Keywords: talin, vinculin, helical bundle, VBS, STRUCTURAL PROTEIN
Deposited on 2005-09-14, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26039 (6-136)
      • cloning artifact (0-5)
    Domains in SCOPe 2.07: d2b0ha1, d2b0ha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b0hA (A:)
    gidpftmgdpegsfvdyqttmvrtakaiavtvqemvtksntspeelgplanqltsdygrl
    asqakpaavaaeneeigahikhrvqelghgcsalvtkagalqcspsdvytkkeliecarr
    vsekvshvlaalqagnr