PDB entry 2b08

View 2b08 on RCSB PDB site
Description: Reduced acetamide-bound M150G Nitrite Reductase from Alcaligenes faecalis
Class: oxidoreductase
Keywords: axial methionine, reorganization energy, Met62, allosteric control, acetamide
Deposited on 2005-09-13, released 2006-09-26
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501
      • engineered (149)
    Domains in SCOP 1.75: d2b08a1, d2b08a2
  • Chain 'B':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501
      • engineered (149)
    Domains in SCOP 1.75: d2b08b1, d2b08b2
  • Chain 'C':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501
      • engineered (149)
    Domains in SCOP 1.75: d2b08c1, d2b08c2
  • Heterogens: CU1, ACM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b08A (A:)
    vrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevh
    amafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgekt
    ilrfkatkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvge
    qdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgek
    vlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgi
    yayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b08A (A:)
    taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
    ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
    katkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvgeqdfy
    vprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvliv
    hsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayv
    nhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b08B (B:)
    vrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevh
    amafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgekt
    ilrfkatkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvge
    qdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgek
    vlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgi
    yayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b08B (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b08C (C:)
    vrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevh
    amafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgekt
    ilrfkatkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvge
    qdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgek
    vlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgi
    yayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b08C (C:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsggngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg