PDB entry 2b06

View 2b06 on RCSB PDB site
Description: Crystal structure of the MutT/nudix family protein from Streptococcus pneumoniae
Class: Structural Genomics/Unknown Function
Keywords: MutT/nudix, Streptococcus pneumoniae, Structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-09-13, released 2006-01-10
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.19
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutT/nudix family protein
    Species: Streptococcus pneumoniae
    Database cross-references and differences (RAF-indexed):
    • GB AAK75341 (0-154)
    Domains in SCOP 1.73: d2b06a1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b06A (A:)
    msrsqltiltnicliedletqrvvmqyrapennrwsgyafpgghvendeafaesvireiy
    eetgltiqnpqlvgiknwpldtggryivicykatefsgtlqsseegevswvqkdqipnln
    laydmlplmemmeapdkseffyprrteddwekkif
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b06A (A:)
    msrsqltiltnicliedletqrvvmqyrawsgyafpgghvendeafaesvireiyeetgl
    tiqnpqlvgiknwpldtggryivicykatefsgtlqsseegevswvqkdqipnlnlaydm
    lplmemmeapdkseffyprrteddwekkif