PDB entry 2b04

View 2b04 on RCSB PDB site
Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with Glycochenodeoxycholate
Class: hydrolase
Keywords: Bile salt, glycochenodeoxycholate, carboxylic ester hydrolase, pancreatic enzyme, HYDROLASE
Deposited on 2005-09-12, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.211
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b04a_
  • Heterogens: CHO, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b04A (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b04A (A:)
    alwqfrsmikcaipgfnnygcycglggsgtpvdeldrccethdncyrdaknldsckflvd
    npytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc