PDB entry 2azz

View 2azz on RCSB PDB site
Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with Taurocholate
Class: hydrolase
Keywords: Bile Salt, Binding, Taurocholate, Carboxylic ester hydrolase, PLA2, Panceartic enzyme
Deposited on 2005-09-12, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: SUS SCROFA
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2azza1
  • Heterogens: CA, CL, TCH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2azzA (A:)
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc