PDB entry 2azx

View 2azx on RCSB PDB site
Description: Charged and uncharged tRNAs adopt distinct conformations when complexed with human tryptophanyl-tRNA synthetase
Class: Ligase/RNA
Keywords: two synthetase-tRNA complex with distinct conformations, association complex and dissociation complex, Ligase-RNA COMPLEX
Deposited on 2005-09-12, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: WARS, WRS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23381
      • modified residue (142)
      • modified residue (168)
      • modified residue (194)
      • variant (212-213)
      • modified residue (240)
      • modified residue (242)
      • modified residue (318)
      • modified residue (349)
      • modified residue (400)
      • modified residue (424)
      • modified residue (460)
    Domains in SCOPe 2.07: d2azxa1
  • Chain 'B':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: WARS, WRS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23381
      • modified residue (142)
      • modified residue (168)
      • modified residue (194)
      • variant (212-213)
      • modified residue (240)
      • modified residue (242)
      • modified residue (318)
      • modified residue (349)
      • modified residue (400)
      • modified residue (424)
      • modified residue (460)
    Domains in SCOPe 2.07: d2azxb1
  • Chain 'C':
    Compound: 72-mer
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 72-mer
    Species: synthetic, synthetic
  • Heterogens: SO4, MG, TRP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2azxA (A:)
    mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
    dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
    eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
    kwlqdvfnvplviqmtddekylwkdltldqaygdavenakdiiacgfdinktfifsdldy
    mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
    tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
    ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
    tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklsfdfqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2azxA (A:)
    edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshr
    dmnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddeky
    lwkdltldqaygdavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfn
    qvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtr
    dvaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggr
    dtieehrqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpl
    iaehqarrkevtdeivkefmtprklsf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2azxB (B:)
    mpnsepasllelfnsiatqgelvrslkagnaskdeidsavkmlvslkmsykaaagedyka
    dcppgnpaptsnhgpdateaeedfvdpwtvqtssakgidydklivrfgsskidkelinri
    eratgqrphhflrrgiffshrdmnqvldayenkkpfylytgrgpsseamhvghlipfift
    kwlqdvfnvplviqmtddekylwkdltldqaygdavenakdiiacgfdinktfifsdldy
    mgmssgfyknvvkiqkhvtfnqvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdr
    tdiqclipcaidqdpyfrmtrdvaprigypkpallhstffpalqgaqtkmsasdpnssif
    ltdtakqiktkvnkhafsggrdtieehrqfggncdvdvsfmyltffledddkleqirkdy
    tsgamltgelkkalievlqpliaehqarrkevtdeivkefmtprklsfdfqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2azxB (B:)
    edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshr
    dmnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddeky
    lwkdltldqaygdavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfn
    qvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtr
    dvaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggr
    dtieehrqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpl
    iaehqarrkevtdeivkefmtprklsfd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.