PDB entry 2azw

View 2azw on RCSB PDB site
Description: Crystal structure of the MutT/nudix family protein from Enterococcus faecalis
Class: structural genomics, unknown function
Keywords: MutT/nudix ,Enterococcus faecalis, Structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-09-12, released 2006-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutT/nudix family protein
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • GB NP_814871 (Start-147)
    Domains in SCOPe 2.08: d2azwa1, d2azwa2
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2azwA (A:)
    mktptfgkreetltyqtryaayiivskpenntmvlvqapngayflpggeiegtetkeeai
    hrevleelgisveigcylgeadeyfysnhrqtayynpgyfyvantwrqlseplertntlh
    wvapeeavrllkrgshrwavekwlaaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2azwA (A:)
    ktptfgkreetltyqtryaayiivskpenntmvlvqapngayflpggeiegtetkeeaih
    revleelgisveigcylgeadeyfysnhrqtayynpgyfyvantwrqlseplrtntlhwv
    apeeavrllkrgshrwavekwlaaas