PDB entry 2azu

View 2azu on RCSB PDB site
Description: x-ray crystal structure of the two site-specific mutants his35*gln and his35*leu of azurin from pseudomonas aeruginosa
Deposited on 1991-01-11, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2azua_
  • Chain 'B':
    Domains in SCOP 1.55: d2azub_
  • Chain 'C':
    Domains in SCOP 1.55: d2azuc_
  • Chain 'D':
    Domains in SCOP 1.55: d2azud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azuA (A:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azuB (B:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azuC (C:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azuD (D:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk