PDB entry 2azu

View 2azu on RCSB PDB site
Description: x-ray crystal structure of the two site-specific mutants his35*gln and his35*leu of azurin from pseudomonas aeruginosa
Class: electron transfer(cuproprotein)
Keywords: electron transfer(cuproprotein)
Deposited on 1991-01-11, released 1993-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d2azua_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d2azub_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d2azuc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d2azud_
  • Heterogens: CU, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azuA (A:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azuB (B:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azuC (C:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2azuD (D:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk