PDB entry 2azt

View 2azt on RCSB PDB site
Description: Crystal structure of H176N mutant of human Glycine N-Methyltransferase
Class: transferase
Keywords: glycine N-methyltransferase, TRANSFERASE
Deposited on 2005-09-12, released 2006-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine n-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14749
      • engineered (176)
    Domains in SCOPe 2.06: d2azta_
  • Chain 'B':
    Compound: glycine n-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GNMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14749
      • engineered (176)
    Domains in SCOPe 2.06: d2aztb_
  • Heterogens: CL, BME, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aztA (A:)
    mvdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgcqr
    vldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrhepafdkwvieeanwmt
    ldkdvpqsaeggfdaviclgnsfahlpdckgdqsehrlalkniasmvraggllvidnrny
    dhilstgcappgkniyyksdltkdvttsvlivnnkahmvtldytvqvpgagqdgspglsk
    frlsyyphclasftellqaafggkcqhsvlgdfkpykpgqtyipcyfihvlkrtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aztA (A:)
    yrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgcqrvldva
    cgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrhepafdkwvieeanwmtldkdv
    pqeggfdaviclgnsfahlpdckgdqsehrlalkniasmvraggllvidnrnydhilstg
    cappgkniyyksdltkdvttsvlivnnkahmvtldytvglskfrlsyyphclasftellq
    aafggkcqhsvlgdfkpykpgqtyipcyfihvlkrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aztB (B:)
    mvdsvyrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgcqr
    vldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrhepafdkwvieeanwmt
    ldkdvpqsaeggfdaviclgnsfahlpdckgdqsehrlalkniasmvraggllvidnrny
    dhilstgcappgkniyyksdltkdvttsvlivnnkahmvtldytvqvpgagqdgspglsk
    frlsyyphclasftellqaafggkcqhsvlgdfkpykpgqtyipcyfihvlkrtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aztB (B:)
    yrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgcqrvldva
    cgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrhepafdkwvieeanwmtldkdv
    pqeggfdaviclgnsfahlpdckgdqsehrlalkniasmvraggllvidnrnydhilstg
    cappgkniyyksdltkdvttsvlivnnkahmvtldytvqglskfrlsyyphclasftell
    qaafggkcqhsvlgdfkpykpgqtyipcyfihvlkrt