PDB entry 2azn

View 2azn on RCSB PDB site
Description: X-RAY Structure of 2,5-diamino-6-ribosylamino-4(3h)-pyrimidinone 5-phosphate reductase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2005-09-12, released 2006-08-29
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58085 (0-218)
      • modified residue (11)
      • modified residue (46)
      • modified residue (116)
      • modified residue (134)
      • modified residue (157)
    Domains in SCOP 1.73: d2azna1
  • Chain 'B':
    Compound: Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58085 (0-218)
      • modified residue (11)
      • modified residue (46)
      • modified residue (116)
      • modified residue (134)
      • modified residue (157)
    Domains in SCOP 1.73: d2aznb1
  • Chain 'C':
    Compound: Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58085 (0-218)
      • modified residue (11)
      • modified residue (46)
      • modified residue (116)
      • modified residue (134)
      • modified residue (157)
    Domains in SCOP 1.73: d2aznc1
  • Chain 'D':
    Compound: Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58085 (0-218)
      • modified residue (11)
      • modified residue (46)
      • modified residue (116)
      • modified residue (134)
      • modified residue (157)
    Domains in SCOP 1.73: d2aznd1
  • Chain 'E':
    Compound: Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58085 (0-218)
      • modified residue (11)
      • modified residue (46)
      • modified residue (116)
      • modified residue (134)
      • modified residue (157)
    Domains in SCOP 1.73: d2azne1
  • Chain 'F':
    Compound: Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase
    Species: Methanococcus jannaschii
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58085 (0-218)
      • modified residue (11)
      • modified residue (46)
      • modified residue (116)
      • modified residue (134)
      • modified residue (157)
    Domains in SCOP 1.73: d2aznf1
  • Heterogens: MA5, NAP, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aznA (A:)
    ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
    tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
    vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
    aptyvdgegfktvdecvklelknfyrlgegivlefkvkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aznB (B:)
    ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
    tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
    vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
    aptyvdgegfktvdecvklelknfyrlgegivlefkvkk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aznC (C:)
    ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
    tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
    vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
    aptyvdgegfktvdecvklelknfyrlgegivlefkvkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aznD (D:)
    ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
    tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
    vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
    aptyvdgegfktvdecvklelknfyrlgegivlefkvkk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aznE (E:)
    ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
    tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
    vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
    aptyvdgegfktvdecvklelknfyrlgegivlefkvkk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aznF (F:)
    ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
    tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
    vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
    aptyvdgegfktvdecvklelknfyrlgegivlefkvkk