PDB entry 2azl

View 2azl on RCSB PDB site
Description: Crystal structure for the mutant F117E of Thermotoga maritima octaprenyl pyrophosphate synthase
Class: transferase
Keywords: OPPs, octaprenyl pyrophosphate synthase, Octaprenyl-diphosphate synthase, trans-prenyltransferase, isoprenyl pyrophosphate synthase, TRANSFERASE
Deposited on 2005-09-12, released 2006-03-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: octoprenyl-diphosphate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • GB NP_229335
      • engineered (116)
    Domains in SCOPe 2.03: d2azla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2azlA (A:)
    mtknklnqnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveig
    edaisslaalelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsaehtv
    eeignnklrraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpal
    legelgedlynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfp
    earqmfenrdwsglmsfmrekgilkeceetlkvlvknviienswlrdfvdgifkikiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2azlA (A:)
    nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
    alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsaehtveeignnkl
    rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
    lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
    rdwsglmsfmrekgilkeceetlkvlvknviienswlrd